PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G12020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 374aa    MW: 36927.4 Da    PI: 7.6969
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G12020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.87.4e-3645101662
           zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        cprC+s +tkfCyynnys++qPryfC++CrryWt+GG+lrnvPvGgg+rk+k+ss
  ONIVA02G12020.1  45 PCCPRCNSIKTKFCYYNNYSMAQPRYFCRECRRYWTQGGSLRNVPVGGGCRKSKRSS 101
                      569***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.0814599IPR003851Zinc finger, Dof-type
PfamPF027011.0E-304699IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-264799IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MASGGALSPV EEKPAVVKTT KAEQHEEEAA VAVKSAAEMM KKSSPCCPRC NSIKTKFCYY  60
NNYSMAQPRY FCRECRRYWT QGGSLRNVPV GGGCRKSKRS SASSASASAA SPPAPAVGAA  120
APPVVPALSS AISKLLQSEP MAAPCADFPN VLPTFVSTGF ELPAAAGDRL SRGSFGAFGN  180
LSAAVAAPGG GGGSSTTTSF MDMLRGVGGL FDGVGNSHQM GGNGGGGGSY YAPLITGAGN  240
GMLMPPPPLP PFSGSLMQHG MQGLFANHAM GGGGGGVMNA GEDGSVMAGL GGGQWPPALG  300
GADEQQGGGD GGEAVMTKDT GGGASSSASR PDYFYGWNSA GGGVIAGGGI GGNAAAATGA  360
TPWQGLIDSS SAMM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623741.10.0PREDICTED: dof zinc finger protein PBF
TrEMBLA0A0E0G4F00.0A0A0E0G4F0_ORYNI; Uncharacterized protein
STRINGLOC_Os02g15350.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP173981010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.14e-29Dof family protein